General Information

  • ID:  hor005955
  • Uniprot ID:  P18889
  • Protein name:  Putative preoptic regulatory factor 1
  • Gene name:  Porf1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Preoptic area and testis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QPEGFADVPG
  • Length:  10
  • Propeptide:  MPYSLQPQPEGFADVPGFPLCMYMVRGSTWTLVPPDL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Precursor for a gonadotropin regulatory hormone (GNRH) related decapeptide.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P18889-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005955_AF2.pdbhor005955_ESM.pdb

Physical Information

Mass: 117679 Formula: C45H65N11O16
Absent amino acids: CHIKLMNRSTWY Common amino acids: GP
pI: 3.55 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -57 Boman Index: -1036
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 5641 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2293025
  • Title:  Cloning of two hypothalamic cDNAs encoding tissue-specific transcripts in the preoptic area and testis.